DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and zgc:153115

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001070797.2 Gene:zgc:153115 / 768186 ZFINID:ZDB-GENE-061013-418 Length:250 Species:Danio rerio


Alignment Length:272 Identity:83/272 - (30%)
Similarity:108/272 - (39%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 FSPFFAA--------SPFFFTYRRISGSGSGNGTGSVSVKQEDNNNSCSYNNGSSSGGAG--SAA 161
            :|.:.||        .|.......:||:......|..:.:.:.::............||.  :.|
Zfish     5 YSDYLAAECLVSISSGPVLHRPTPVSGAAQAPPQGLPAGEPDGSSEDREVRETLRLDGANMMTVA 69

  Fly   162 NSMQDYESKFSLLSLFKNPYKFAGGDG---QASRKTSPT---GGSSKPLASNSSPSWKSYAGSGS 220
            ..:.|...||..:|.:......:.|:.   ..|..|:||   ..|:.|:...|...|        
Zfish    70 EILTDLHGKFRPMSAYSESSNSSCGESGYTTLSDSTTPTPTMTPSATPVPGQSQQIW-------- 126

  Fly   221 PHAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTE 285
                                         ||||:....|                  |.|.|..:
Zfish   127 -----------------------------GGGGAPRSPT------------------KRHPCTFD 144

  Fly   286 GCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFS 350
            |||:||.||||||||.||||||:|:.|||..|..:|||||||.||.|.|||.|.|.|.||.:.|.
Zfish   145 GCDRVYGKSSHLKAHIRTHTGERPFPCTWPECEKKFARSDELARHLRTHTGEKRFLCPLCDKRFM 209

  Fly   351 RSDHLSLHMRRH 362
            |||||..|.|||
Zfish   210 RSDHLIKHARRH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 46/78 (59%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 12/16 (75%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 14/24 (58%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
zgc:153115NP_001070797.2 C2H2 Zn finger 144..163 CDD:275368 14/18 (78%)
COG5048 153..>201 CDD:227381 33/47 (70%)
zf-H2C2_2 155..182 CDD:290200 17/26 (65%)
C2H2 Zn finger 171..193 CDD:275368 14/21 (67%)
zf-H2C2_2 185..208 CDD:290200 13/22 (59%)
zf-C2H2 199..221 CDD:278523 12/21 (57%)
C2H2 Zn finger 201..221 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.