DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and KLF10

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_005646.1 Gene:KLF10 / 7071 HGNCID:11810 Length:480 Species:Homo sapiens


Alignment Length:91 Identity:58/91 - (63%)
Similarity:65/91 - (71%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 DLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTG 336
            |.|:.|. |.|...||.|.|.||||||||.||||||||:.|:|:||..||||||||:||.|.|||
Human   362 DSSRIRS-HICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTG 425

  Fly   337 VKPFRCQLCTRSFSRSDHLSLHMRRH 362
            .|.|.|.:|.|.|.|||||:.|.|||
Human   426 EKKFACPMCDRRFMRSDHLTKHARRH 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 48/78 (62%)
zf-C2H2 280..304 CDD:278523 15/23 (65%)
C2H2 Zn finger 282..304 CDD:275368 14/21 (67%)
zf-H2C2_2 296..>313 CDD:290200 13/16 (81%)
C2H2 Zn finger 312..334 CDD:275368 15/21 (71%)
zf-H2C2_2 326..351 CDD:290200 14/24 (58%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
KLF10NP_005646.1 zf-C2H2 369..393 CDD:278523 15/23 (65%)
COG5048 374..>424 CDD:227381 35/49 (71%)
C2H2 Zn finger 374..393 CDD:275368 13/18 (72%)
zf-H2C2_2 385..412 CDD:290200 19/26 (73%)
C2H2 Zn finger 401..423 CDD:275368 15/21 (71%)
zf-H2C2_2 415..438 CDD:290200 13/22 (59%)
zf-C2H2 429..451 CDD:278523 12/21 (57%)
C2H2 Zn finger 431..451 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.