DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and klf17

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_571798.1	Gene:	klf17 / 65238	ZFINID:	ZDB-GENE-010129-1	Length:	409	Species:	Danio rerio

Alignment Length:	107	Identity:	70/107 - (65%)
Similarity:	81/107 - (75%)	Gaps:	1/107 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 GFTTSSDSMANGGYNDLSKNR-KVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWR 320
            ||.:..||....|....::.| ..|.|:..||.|.||||||||||.|||||||||.|:||||.|:
Zfish   302 GFLSPEDSKPKRGRRSWARKRTATHSCEFPGCGKTYTKSSHLKAHMRTHTGEKPYHCSWEGCGWK 366

  Fly   321 FARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            ||||||||||||||||.:||:|.||.|:|||||||:|||:||
Zfish   367 FARSDELTRHYRKHTGHRPFQCHLCERAFSRSDHLALHMKRH 408

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	55/79 (70%)
		zf-C2H2	280..304	CDD:278523	16/23 (70%)
		C2H2 Zn finger	282..304	CDD:275368	15/21 (71%)
		zf-H2C2_2	296..>313	CDD:290200	14/16 (88%)
		C2H2 Zn finger	312..334	CDD:275368	18/21 (86%)
		zf-H2C2_2	326..351	CDD:290200	18/24 (75%)
		C2H2 Zn finger	342..362	CDD:275368	14/19 (74%)
klf17	NP_571798.1	COG5048	<248..>393	CDD:227381	57/90 (63%)
		zf-C2H2	326..350	CDD:278523	16/23 (70%)
		C2H2 Zn finger	331..350	CDD:275368	14/18 (78%)
		zf-H2C2_2	342..>358	CDD:290200	14/15 (93%)
		C2H2 Zn finger	358..380	CDD:275368	18/21 (86%)
		zf-H2C2_2	372..397	CDD:290200	18/24 (75%)
		C2H2 Zn finger	388..408	CDD:275368	14/19 (74%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170594816
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	4	3.940