DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf6

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_113830.2 Gene:Klf6 / 58954 RGDID:62389 Length:317 Species:Rattus norvegicus


Alignment Length:231 Identity:96/231 - (41%)
Similarity:122/231 - (52%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EDNNNSCSYN-----NGSSSGGAGSAANSMQDYE--SKFSLLSLFKNPY-KFAGGDGQASRKTSP 196
            ||:..|..:|     |..:|..:..:::|.::..  :||:     .:|. :.....|..|.....
  Rat   121 EDSLISSGFNYNLETNSLNSDVSSESSDSSEELSPTTKFT-----SDPIGEVLVNSGNLSSSVIS 180

  Fly   197 TGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTS 261
            |..||..:...||..|                  |.|.|    |..|...:..|..|.: |...|
  Rat   181 TPPSSPEVNRESSQLW------------------GCGPG----DLPSPGKVRSGTSGKS-GDKGS 222

  Fly   262 SDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDE 326
            .|:..:|       .|:||:|...||.||||||||||||:|||||||||.|:||||.||||||||
  Rat   223 GDASPDG-------RRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDE 280

  Fly   327 LTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            ||||:|||||.|||:|..|.|.|||||||:|||:||
  Rat   281 LTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 57/78 (73%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 16/21 (76%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 18/21 (86%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
Klf6NP_113830.2 COG5048 211..>299 CDD:227381 59/95 (62%)
zf-C2H2 234..258 CDD:278523 17/23 (74%)
C2H2 Zn finger 239..258 CDD:275368 15/18 (83%)
zf-H2C2_2 250..>266 CDD:290200 14/15 (93%)
C2H2 Zn finger 266..288 CDD:275368 18/21 (86%)
zf-H2C2_2 280..305 CDD:290200 17/24 (71%)
C2H2 Zn finger 296..316 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.