DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and klf9

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_001122201.1	Gene:	klf9 / 565869	ZFINID:	ZDB-GENE-060526-244	Length:	216	Species:	Danio rerio

Alignment Length:	85	Identity:	54/85 - (63%)
Similarity:	62/85 - (72%)	Gaps:	0/85 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   278 KVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRC 342
            |.|.|...||.|:|.||||||||.|.||||:|:.|||.||..:|:||||||||:|.|||.|.|.|
Zfish    97 KRHCCPYAGCGKIYGKSSHLKAHFRVHTGERPFQCTWPGCAKKFSRSDELTRHFRTHTGEKRFMC 161

  Fly   343 QLCTRSFSRSDHLSLHMRRH 362
            .||.:.|.|||||:.|.|||
Zfish   162 PLCDKCFMRSDHLTKHARRH 181

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	45/73 (62%)
		zf-C2H2	280..304	CDD:278523	15/23 (65%)
		C2H2 Zn finger	282..304	CDD:275368	14/21 (67%)
		zf-H2C2_2	296..>313	CDD:290200	11/16 (69%)
		C2H2 Zn finger	312..334	CDD:275368	15/21 (71%)
		zf-H2C2_2	326..351	CDD:290200	15/24 (63%)
		C2H2 Zn finger	342..362	CDD:275368	11/19 (58%)
klf9	NP_001122201.1	C2H2 Zn finger	101..123	CDD:275368	14/21 (67%)
		COG5048	113..>161	CDD:227381	33/47 (70%)
		C2H2 Zn finger	131..153	CDD:275368	15/21 (71%)
		zf-H2C2_2	145..168	CDD:290200	14/22 (64%)
		zf-C2H2	159..181	CDD:278523	12/21 (57%)
		C2H2 Zn finger	161..181	CDD:275368	11/19 (58%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000436
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910