DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf5b

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_688525.5 Gene:klf5b / 560043 ZFINID:ZDB-GENE-080424-4 Length:344 Species:Danio rerio


Alignment Length:377 Identity:124/377 - (32%)
Similarity:162/377 - (42%) Gaps:125/377 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GPPVQVEPVDLSLRSPRASTSHGSSSSSYKFSSANKAVG-------YSN-GKPGGSSGSSSSSGF 75
            ||.::.||:                .||:.:||.:..|.       |:| ..|...:||:     
Zfish    58 GPQIKTEPI----------------HSSFNYSSCHGTVAPTMTHQEYTNLYTPAPETGSN----- 101

  Fly    76 GAGSAGSSSLGAFAAQQQQQLYASSGVSKLPFSPFFAASPFFFTYRRISGSGSGNGTGSVSVKQE 140
                                :|.......:.|...    |.|   :.::.....|..|..|. .:
Zfish   102 --------------------VYIKHETPSIEFQDV----PLF---QLLNSDLEPNVPGGHSC-TD 138

  Fly   141 DNNNSC----SYNN---GSSSGGAGSAANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTS--- 195
            .:|.:|    :||:   .||.|             ::.|:.::..|.|......||..:|.:   
Zfish   139 SHNATCPPMSTYNSIHPASSHG-------------TERSICNMASNGYSLPAQFGQHPQKRAAYL 190

  Fly   196 -PTGGSSKP--------LASNSSPSWKSYAGS-GSPHAALNPAFGGMGRGATRKDNSSFSGINFG 250
             |:..:|:|        |..|.||. .|||.| .|..|.|.|                       
Zfish   191 PPSPPNSEPGSPDRRKELIQNLSPP-PSYAASMASKMACLTP----------------------- 231

  Fly   251 GGGSAFGFTTSSDSMANGGYN-----DLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPY 310
              |.|....|   ......||     ||.| |::|.||..||.||||||||||||.|||||||||
Zfish   232 --GPALSVQT---QQVPAQYNRRSNPDLDK-RRIHHCDVPGCKKVYTKSSHLKAHLRTHTGEKPY 290

  Fly   311 VCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            .|:||||.||||||||||||:|||||.|||:|.:|:|.|||||||:|||:||
Zfish   291 KCSWEGCDWRFARSDELTRHFRKHTGAKPFQCSVCSRCFSRSDHLALHMKRH 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 59/78 (76%)
zf-C2H2 280..304 CDD:278523 18/23 (78%)
C2H2 Zn finger 282..304 CDD:275368 17/21 (81%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 18/21 (86%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
klf5bXP_688525.5 COG5048 236..>323 CDD:227381 58/90 (64%)
C2H2 Zn finger 265..284 CDD:275368 15/18 (83%)
C2H2 Zn finger 292..314 CDD:275368 18/21 (86%)
zf-H2C2_2 306..331 CDD:290200 17/24 (71%)
C2H2 Zn finger 322..342 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.