Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067341.2 | Gene: | Klf13 / 50794 | MGIID: | 1354948 | Length: | 289 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 86/243 - (35%) |
---|---|---|---|
Similarity: | 110/243 - (45%) | Gaps: | 65/243 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 GAGSAANSM---------QDYESKFSLLSLFKN-------PYKFAGGDGQASRK----------- 193
Fly 194 -TSPTG------GSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGG 251
Fly 252 --GGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTW 314
Fly 315 EGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 46/78 (59%) |
zf-C2H2 | 280..304 | CDD:278523 | 17/23 (74%) | ||
C2H2 Zn finger | 282..304 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 296..>313 | CDD:290200 | 12/16 (75%) | ||
C2H2 Zn finger | 312..334 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 326..351 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 10/19 (53%) | ||
Klf13 | NP_067341.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..54 | 4/16 (25%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 70..168 | 25/126 (20%) | |||
COG5048 | <163..253 | CDD:227381 | 54/88 (61%) | ||
C2H2 Zn finger | 170..192 | CDD:275368 | 15/21 (71%) | ||
C2H2 Zn finger | 200..222 | CDD:275368 | 14/21 (67%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 10/19 (53%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..289 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |