DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf13

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_067341.2 Gene:Klf13 / 50794 MGIID:1354948 Length:289 Species:Mus musculus


Alignment Length:243 Identity:86/243 - (35%)
Similarity:110/243 - (45%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GAGSAANSM---------QDYESKFSLLSLFKN-------PYKFAGGDGQASRK----------- 193
            ||.:||.::         :|..|.|.:..:..:       |......:|.|:||           
Mouse    37 GAAAAAPTLPRVDERRDGKDSASLFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPAP 101

  Fly   194 -TSPTG------GSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGG 251
             ..|.|      |.:...|:..||:|      ..|.|||....|..|.|.        .|:...|
Mouse   102 PAPPPGPEPASPGQAGAPAAPPSPAW------SEPEAALEQEPGPAGSGE--------PGLRQRG 152

  Fly   252 --GGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTW 314
              |.|.               .||...::.|||...||:|||.||||||||.||||||:|:.|:|
Mouse   153 RRGRSR---------------ADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSW 202

  Fly   315 EGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            :.|..:|||||||.||||.|||.|.|.|.:|.:.|.|||||:.|.|||
Mouse   203 QECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 46/78 (59%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 12/16 (75%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 14/24 (58%)
C2H2 Zn finger 342..362 CDD:275368 10/19 (53%)
Klf13NP_067341.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..168 25/126 (20%)
COG5048 <163..253 CDD:227381 54/88 (61%)
C2H2 Zn finger 170..192 CDD:275368 15/21 (71%)
C2H2 Zn finger 200..222 CDD:275368 14/21 (67%)
C2H2 Zn finger 230..250 CDD:275368 10/19 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..289 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.