DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and CG3065

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:126 Identity:57/126 - (45%)
Similarity:69/126 - (54%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 TRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHK 301
            |..::.|..|   |.|.|......|...||....:| .|.:.|  |..:.|.|.|.|||||::|.
  Fly    72 TEPEDDSHYG---GNGNSKIRIMPSVKLMATTLASD-PKRKFV--CPYDNCTKSYGKSSHLRSHL 130

  Fly   302 RTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            ..|||.||:||:...|...|.|||||.||.|.|||.|||.|..||:.|||||||:.|:..|
  Fly   131 TWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFECIQCTKKFSRSDHLTKHLATH 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 40/78 (51%)
zf-C2H2 280..304 CDD:278523 10/23 (43%)
C2H2 Zn finger 282..304 CDD:275368 10/21 (48%)
zf-H2C2_2 296..>313 CDD:290200 9/16 (56%)
C2H2 Zn finger 312..334 CDD:275368 11/21 (52%)
zf-H2C2_2 326..351 CDD:290200 15/24 (63%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 48/96 (50%)
C2H2 Zn finger 111..133 CDD:275368 10/21 (48%)
zf-C2H2 139..163 CDD:278523 12/23 (52%)
C2H2 Zn finger 141..163 CDD:275368 11/21 (52%)
zf-H2C2_2 155..180 CDD:290200 15/24 (63%)
C2H2 Zn finger 171..191 CDD:275368 11/19 (58%)
zf-C2H2 346..368 CDD:278523
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.