DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and zf30C

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_477301.1	Gene:	zf30C / 34292	FlyBaseID:	FBgn0270924	Length:	777	Species:	Drosophila melanogaster

Alignment Length:	112	Identity:	32/112 - (28%)
Similarity:	50/112 - (44%)	Gaps:	9/112 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 FGFTTSSDSMANGGYNDLSKNRKVHKCDT----EGCDKVYTKSSHLKAHKRT-HTGEKPYVCTWE 315
            :|.:.....::..|.  |..:..:||.||    :.|.|.:...:..|:|.:| ||..|||.|  .
  Fly   573 YGCSVCGKHLSTAGI--LKTHMLLHKADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKC--H 633

  Fly   316 GCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            .|...:...:.|..|...|||:|.|.|..|.:.|:...:|..|.:.|
  Fly   634 LCPKEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHRKVH 680

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	27/83 (33%)
		zf-C2H2	280..304	CDD:278523	9/28 (32%)
		C2H2 Zn finger	282..304	CDD:275368	7/26 (27%)
		zf-H2C2_2	296..>313	CDD:290200	8/17 (47%)
		C2H2 Zn finger	312..334	CDD:275368	4/21 (19%)
		zf-H2C2_2	326..351	CDD:290200	10/24 (42%)
		C2H2 Zn finger	342..362	CDD:275368	5/19 (26%)
zf30C	NP_477301.1	C2H2 Zn finger	33..53	CDD:275368
		C2H2 Zn finger	61..82	CDD:275368
		C2H2 Zn finger	98..117	CDD:275368
		C2H2 Zn finger	134..152	CDD:275368
		C2H2 Zn finger	511..532	CDD:275370
		COG5048	<523..>672	CDD:227381	29/102 (28%)
		C2H2 Zn finger	546..566	CDD:275368
		C2H2 Zn finger	575..595	CDD:275368	2/21 (10%)
		C2H2 Zn finger	603..624	CDD:275368	5/20 (25%)
		C2H2 Zn finger	632..652	CDD:275368	4/21 (19%)
		C2H2 Zn finger	660..680	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3BRQ6
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900