DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf15

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster


Alignment Length:313 Identity:89/313 - (28%)
Similarity:135/313 - (43%) Gaps:75/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FAAQQQQQLYASSGVSKLPFS------PFFAASPFFFTYRRISGSGSGNGTGSVSVKQED----- 141
            ||....||||  |.:.:.|.:      ...:...|..||  :..|.||.....:..::.|     
  Fly     4 FATGGFQQLY--SDLEEEPLAGGDALLNIVSVGEFDSTY--VDTSFSGGNYNQLEFEESDYYGII 64

  Fly   142 ----NNNSCSYNNGSSSGGAGSAAN---------------SMQDYESKFSLLSLFKNPYKFAGGD 187
                |||  :..||:...|.....:               .:.|:|.:     |..|..:.....
  Fly    65 TLDSNNN--TNTNGNIQVGLPHVEDPSLFIDFNDLTVCPPDLSDWEQR-----LLDNYVEIPDLV 122

  Fly   188 GQASRKTSPTGGSSKPLASNSSPSWKSYAG-----SGSPHAALNPAFGGMGRGATRKDNSSFSGI 247
            .....:|        ||.:::...:...:.     ||.||:.:           ...|.||.|. 
  Fly   123 DFLPERT--------PLCTDNCADFLEESNSNLRLSGPPHSEI-----------FVPDRSSSSP- 167

  Fly   248 NFGGGGSAFGFTTSSDSMANGGYNDLSKN---RKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKP 309
              |...||    :.::::|......:|:|   .:.:.|....|:|:|.|.:|||||.|.|.||||
  Fly   168 --GSSDSA----SPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKP 226

  Fly   310 YVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |||:|..|:|||:|||||.||.|.|:||||::|..|::.|:|||||:.|.:.|
  Fly   227 YVCSWPDCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 42/81 (52%)
zf-C2H2 280..304 CDD:278523 11/23 (48%)
C2H2 Zn finger 282..304 CDD:275368 11/21 (52%)
zf-H2C2_2 296..>313 CDD:290200 13/16 (81%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 13/24 (54%)
C2H2 Zn finger 342..362 CDD:275368 9/19 (47%)
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 46/78 (59%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 14/21 (67%)
zf-H2C2_2 243..268 CDD:290200 13/24 (54%)
C2H2 Zn finger 259..279 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455434
Domainoid 1 1.000 40 1.000 Domainoid score I3723
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.