DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf14

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001128566.1 Gene:Klf14 / 312203 RGDID:1306012 Length:321 Species:Rattus norvegicus


Alignment Length:300 Identity:94/300 - (31%)
Similarity:124/300 - (41%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GAGSAGSSSLGAFAAQQQQQLYASSGVSKLPFSPFF---AASPFFFTYRRISGSGSGNGTGSVSV 137
            |||:|..|.:|..:.:...:...|.||..:|  |..   |.||           |.|:|...:..
  Rat    34 GAGAAAVSEVGEVSRESAGKGTGSRGVLWIP--PVLEVPAPSP-----------GEGDGAPHLLA 85

  Fly   138 KQEDNNNSCSYNNGSSSGGAGSAANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTGGSSK 202
            .....:.||....|:......:...|...:|                     .::.:||| |.|:
  Rat    86 ASALADLSCGAREGTKEDSEEAPCASTSCFE---------------------PTQCSSPT-GCSE 128

  Fly   203 PL-------ASNSSPSWKSYAGSGSPHAALNPAFGG---MGRGATRKDNSSFSGINFGGGGSAFG 257
            |.       .|::..|....|..|:|.....|...|   .|....|.             |.|.|
  Rat   129 PTQTFGEDELSDAESSCSESAILGAPEVPEEPDDSGEVPEGPPGARP-------------GPAVG 180

  Fly   258 FTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFA 322
            .|...        ..::...|.|:|...||:|.|.||||||:|:||||||:|:.|.|..|..:|.
  Rat   181 PTYRR--------RQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFT 237

  Fly   323 RSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |||||.||||.|||.|.|.|.||.:.|||||||:.|.|||
  Rat   238 RSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 44/78 (56%)
zf-C2H2 280..304 CDD:278523 14/23 (61%)
C2H2 Zn finger 282..304 CDD:275368 13/21 (62%)
zf-H2C2_2 296..>313 CDD:290200 11/16 (69%)
C2H2 Zn finger 312..334 CDD:275368 13/21 (62%)
zf-H2C2_2 326..351 CDD:290200 15/24 (63%)
C2H2 Zn finger 342..362 CDD:275368 12/19 (63%)
Klf14NP_001128566.1 COG5048 198..>283 CDD:227381 49/79 (62%)
C2H2 Zn finger 200..219 CDD:275368 12/18 (67%)
zf-H2C2_2 211..238 CDD:290200 15/26 (58%)
C2H2 Zn finger 227..249 CDD:275368 13/21 (62%)
zf-H2C2_2 241..266 CDD:290200 15/24 (63%)
C2H2 Zn finger 257..277 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.