DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and klf1

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_571011.1	Gene:	klf1 / 30104	ZFINID:	ZDB-GENE-980526-55	Length:	365	Species:	Danio rerio

Alignment Length:	90	Identity:	64/90 - (71%)
Similarity:	74/90 - (82%)	Gaps:	0/90 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   273 LSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGV 337
            :.:...||.|:..||.|.||||||||||.|||||||||.|||:||.|:||||||||||:|||||.
Zfish   275 VKRKATVHSCEYPGCQKTYTKSSHLKAHLRTHTGEKPYHCTWDGCGWKFARSDELTRHFRKHTGQ 339

  Fly   338 KPFRCQLCTRSFSRSDHLSLHMRRH 362
            ||:.|.||.|:|||||||:|||:||
Zfish   340 KPYECLLCHRAFSRSDHLALHMKRH 364

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	54/78 (69%)
		zf-C2H2	280..304	CDD:278523	16/23 (70%)
		C2H2 Zn finger	282..304	CDD:275368	15/21 (71%)
		zf-H2C2_2	296..>313	CDD:290200	14/16 (88%)
		C2H2 Zn finger	312..334	CDD:275368	17/21 (81%)
		zf-H2C2_2	326..351	CDD:290200	17/24 (71%)
		C2H2 Zn finger	342..362	CDD:275368	14/19 (74%)
klf1	NP_571011.1	COG5048	287..>344	CDD:227381	45/56 (80%)
		C2H2 Zn finger	287..306	CDD:275368	14/18 (78%)
		zf-H2C2_2	298..>315	CDD:290200	14/16 (88%)
		C2H2 Zn finger	314..336	CDD:275368	17/21 (81%)
		zf-H2C2_2	328..353	CDD:290200	17/24 (71%)
		C2H2 Zn finger	344..364	CDD:275368	14/19 (74%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170594815
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000436
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	4	3.940