DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Zfp353

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_233185.6 Gene:Zfp353 / 298232 RGDID:1310095 Length:551 Species:Rattus norvegicus


Alignment Length:239 Identity:71/239 - (29%)
Similarity:106/239 - (44%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GTGSVSVKQEDNNNSCSYNNGSSSGGAGSAANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTS 195
            ||...:..:|||   .:::..:|.....:..:.|:        .|:.:|.|....|..:......
  Rat   340 GTKRTTSSEEDN---LAWHPETSLSSEETFLDQMR--------TSVDQNVYPSHNGTLKIEESLE 393

  Fly   196 PTGGSSKPLASNSSPSWKSYAG-----SGSPHAALNPAFGGMGRGATRKDNSSFSGINFGGGGS- 254
            |...|    .||.:|    |.|     |.||...:.|           ::.||.||::.|.... 
  Rat   394 PQVTS----LSNQAP----YVGESSDTSNSPLIQIQP-----------QEISSASGLDQGQHPEI 439

  Fly   255 AFGFTTSSD-SMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCI 318
            .....|.|. |:.|      ..|.|.:.|..:||.|.|.||.|||.|.:.|||.|||:|...||.
  Rat   440 KLDLKTQSPVSLKN------PHNSKRYCCTYQGCKKSYKKSQHLKDHMKKHTGVKPYMCNKPGCD 498

  Fly   319 WRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |:|.|..:|.||.:||:|.:|:.|.:|.:::||..:|..|:|.|
  Rat   499 WKFFRLVDLNRHKQKHSGERPYPCPMCNKNYSRFYYLKQHLRSH 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 35/78 (45%)
zf-C2H2 280..304 CDD:278523 11/23 (48%)
C2H2 Zn finger 282..304 CDD:275368 11/21 (52%)
zf-H2C2_2 296..>313 CDD:290200 10/16 (63%)
C2H2 Zn finger 312..334 CDD:275368 9/21 (43%)
zf-H2C2_2 326..351 CDD:290200 9/24 (38%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
Zfp353XP_233185.6 C2H2 Zn finger 462..484 CDD:275368 11/21 (52%)
C2H2 Zn finger 492..514 CDD:275368 9/21 (43%)
zf-H2C2_2 506..531 CDD:290200 9/24 (38%)
C2H2 Zn finger 522..542 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.