DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf6a

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_958869.2 Gene:klf6a / 280650 ZFINID:ZDB-GENE-021115-9 Length:283 Species:Danio rerio


Alignment Length:273 Identity:109/273 - (39%)
Similarity:139/273 - (50%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LPFSPFFAASPFFFTYRR-------ISGSGSGNGTGSVSVKQEDNNNSCSY--NNGSSSGGAGSA 160
            |...|:.:||...|..:.       ::....|:|.||:...:||:|..|..  .|..:|..:..|
Zfish    43 LQSEPYVSASDLKFEGQEDLWSKLILACGDKGDGNGSLPSVKEDDNQDCQILETNSMNSDASSEA 107

  Fly   161 ANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTG-GSSKPLAS---NSSPSWKSYAGSGSP 221
            ::|                           |.:.|||. .:|.||.|   .|:....|...|..|
Zfish   108 SDS---------------------------SEELSPTHIFTSNPLGSVLTESAHHLSSSIISTPP 145

  Fly   222 HAALNPAFGGMGR--GATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDT 284
            .:...|...|:.:  |:|:.|......|...|.|.|...||:      ||.......|:||:|..
Zfish   146 SSPEMPQEPGVPQVWGSTQTDLHIPVKIRQNGLGKALDKTTT------GGDASPDGRRRVHRCHF 204

  Fly   285 EGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSF 349
            .||.||||||||||||:|||||||||.|:||||.||||||||||||:|||||.|||:|..|.|.|
Zfish   205 NGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCF 269

  Fly   350 SRSDHLSLHMRRH 362
            ||||||:|||:||
Zfish   270 SRSDHLALHMKRH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 57/78 (73%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 16/21 (76%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 18/21 (86%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
klf6aNP_958869.2 COG5048 171..>265 CDD:227381 61/99 (62%)
C2H2 Zn finger 205..224 CDD:275368 15/18 (83%)
C2H2 Zn finger 232..254 CDD:275368 18/21 (86%)
zf-H2C2_2 246..271 CDD:290200 17/24 (71%)
C2H2 Zn finger 262..282 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.