| Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_659032.3 | Gene: | Wt1 / 22431 | MGIID: | 98968 | Length: | 517 | Species: | Mus musculus |
| Alignment Length: | 47 | Identity: | 12/47 - (25%) |
|---|---|---|---|
| Similarity: | 20/47 - (42%) | Gaps: | 5/47 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 357 VDSGPPTYAFNPCGH-MATEKTVKYWANVDIPHGTNGFQSVCPFCAT 402 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | |
| C2H2 Zn finger | 282..304 | CDD:275368 | |||
| C2H2 Zn finger | 312..334 | CDD:275368 | |||
| zf-H2C2_2 | 326..351 | CDD:463886 | |||
| C2H2 Zn finger | 342..362 | CDD:275368 | 0/4 (0%) | ||
| Wt1 | NP_659032.3 | WT1 | 69..389 | CDD:460471 | 12/47 (26%) |
| COG5048 | 381..>509 | CDD:227381 | |||
| C2H2 Zn finger | 396..415 | CDD:275368 | |||
| C2H2 Zn finger | 423..445 | CDD:275368 | |||
| C2H2 Zn finger | 453..473 | CDD:275368 | |||
| C2H2 Zn finger | 484..506 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||