DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf-3

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:228 Identity:89/228 - (39%)
Similarity:110/228 - (48%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AANSMQDYESKFSLLSLFKNPYKF-AGGDGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHA 223
            |..|.:.|...:....:..|||.. ...|......|..|..|:..|.|.:.|:.|......||..
 Worm   100 APPSYETYPEVYYPPHIICNPYDVPTTSDRNPPYYTEVTTVSAVTLHSMTPPTHKIETPPSSPEN 164

  Fly   224 ALNPAFGGMGR----------------GATRKDNSSFSGINFGGGGSAFGFTTSSD--------S 264
            :..|....:..                .:||...||               ||||:        .
 Worm   165 SFGPLASQLPAIKMEIPMHPLPHNGELDSTRSSPSS---------------TTSSERSPLQRKSR 214

  Fly   265 MANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTR 329
            :.:...|...|...||.|...||.|.|:||||||||:|||:||||:||.|:.|.|:|||||||||
 Worm   215 IESNKRNPTDKKFVVHACTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTR 279

  Fly   330 HYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |.|||||.|||||.||.|:|:|||||||||:||
 Worm   280 HMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 52/78 (67%)
zf-C2H2 280..304 CDD:278523 15/23 (65%)
C2H2 Zn finger 282..304 CDD:275368 14/21 (67%)
zf-H2C2_2 296..>313 CDD:290200 13/16 (81%)
C2H2 Zn finger 312..334 CDD:275368 15/21 (71%)
zf-H2C2_2 326..351 CDD:290200 19/24 (79%)
C2H2 Zn finger 342..362 CDD:275368 14/19 (74%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 13/18 (72%)
C2H2 Zn finger 262..284 CDD:275368 15/21 (71%)
zf-H2C2_2 276..301 CDD:290200 19/24 (79%)
C2H2 Zn finger 292..312 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I8214
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.