Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495833.1 | Gene: | sptf-2 / 188733 | WormBaseID: | WBGene00011926 | Length: | 166 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 63/195 - (32%) |
---|---|---|---|
Similarity: | 85/195 - (43%) | Gaps: | 62/195 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 DGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGG 251
Fly 252 GGSAFGFTTSSDSMANGGYNDLSKNRK----------------------VHKCDTEGCDKVYTKS 294
Fly 295 SHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHM 359
Fly 360 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 40/100 (40%) |
zf-C2H2 | 280..304 | CDD:278523 | 13/23 (57%) | ||
C2H2 Zn finger | 282..304 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 296..>313 | CDD:290200 | 10/16 (63%) | ||
C2H2 Zn finger | 312..334 | CDD:275368 | 12/21 (57%) | ||
zf-H2C2_2 | 326..351 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 11/18 (61%) | ||
sptf-2 | NP_495833.1 | COG5048 | <75..156 | CDD:227381 | 43/80 (54%) |
C2H2 Zn finger | 82..101 | CDD:275368 | 11/18 (61%) | ||
C2H2 Zn finger | 109..131 | CDD:275368 | 12/21 (57%) | ||
C2H2 Zn finger | 139..156 | CDD:275368 | 10/16 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1623 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.860 |