DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and sptf-2

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:195 Identity:63/195 - (32%)
Similarity:85/195 - (43%) Gaps:62/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGG 251
            ||.|::...|               |:|:   ||.|.:| |:.......|:              
 Worm     2 DGAATKFFRP---------------WESH---GSYHHSL-PSISPPDSPAS-------------- 33

  Fly   252 GGSAFGFTTSSDSMANGGYNDLSKNRK----------------------VHKCDTEGCDKVYTKS 294
                   |::|.|.::.|.|:|:..|:                      .|.|...||.|.|.|:
 Worm    34 -------TSASSSSSSIGANELTTKRRKCERCTCPNCKAIKHGDRGSQHTHLCSVPGCGKTYKKT 91

  Fly   295 SHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHM 359
            |||:||.|.|||::|:||.|..|..||.|||:|.||.|.||....|.|:.|.|.|||||||..|:
 Worm    92 SHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHTKEYRFACKFCIRQFSRSDHLQQHL 156

  Fly   360  359
             Worm   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 40/100 (40%)
zf-C2H2 280..304 CDD:278523 13/23 (57%)
C2H2 Zn finger 282..304 CDD:275368 12/21 (57%)
zf-H2C2_2 296..>313 CDD:290200 10/16 (63%)
C2H2 Zn finger 312..334 CDD:275368 12/21 (57%)
zf-H2C2_2 326..351 CDD:290200 11/24 (46%)
C2H2 Zn finger 342..362 CDD:275368 11/18 (61%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 43/80 (54%)
C2H2 Zn finger 82..101 CDD:275368 11/18 (61%)
C2H2 Zn finger 109..131 CDD:275368 12/21 (57%)
C2H2 Zn finger 139..156 CDD:275368 10/16 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1623
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.