DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf-2

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_507995.2 Gene:klf-2 / 186179 WormBaseID:WBGene00009998 Length:299 Species:Caenorhabditis elegans


Alignment Length:97 Identity:67/97 - (69%)
Similarity:74/97 - (76%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 SKNR--------KVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRH 330
            ||.|        :||||..:||.|||||||||.||:|.|:|||||.|.|.||.||||||||||||
 Worm   184 SKRRDKATLDRLRVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWPGCSWRFARSDELTRH 248

  Fly   331 YRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            ||||||.|||.|:.|:|.|||||||.|||:||
 Worm   249 YRKHTGAKPFACKECSRKFSRSDHLQLHMKRH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 57/85 (67%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 11/16 (69%)
C2H2 Zn finger 312..334 CDD:275368 18/21 (86%)
zf-H2C2_2 326..351 CDD:290200 18/24 (75%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
klf-2NP_507995.2 C2H2 Zn finger 205..222 CDD:275368 13/16 (81%)
C2H2 Zn finger 230..252 CDD:275368 18/21 (86%)
zf-H2C2_2 244..269 CDD:290200 18/24 (75%)
C2H2 Zn finger 260..280 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.