DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf9

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_034768.2 Gene:Klf9 / 16601 MGIID:1333856 Length:244 Species:Mus musculus


Alignment Length:225 Identity:80/225 - (35%)
Similarity:103/225 - (45%) Gaps:67/225 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GSAANSMQDYESKF----SLLSLFK---------------NPYKFAGGDGQASRKTSPTGGSSKP 203
            |...::.:||.:..    |||.|.|               :|.:..|.|...:.::    |||  
Mouse    48 GDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDIGSDSDVTTES----GSS-- 106

  Fly   204 LASNSSPSWKSYAGSG-SPHAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMAN 267
              .:.||..:..:||. ||.:.|:......|:.|:.|.                           
Mouse   107 --PSHSPEERQDSGSAPSPLSLLHSGVASKGKHASEKR--------------------------- 142

  Fly   268 GGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYR 332
                        |||...||.|||.||||||||.|.||||:|:.|||..|:.:|:||||||||||
Mouse   143 ------------HKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYR 195

  Fly   333 KHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            .|||.|.|||.||.:.|.|||||:.|.|||
Mouse   196 THTGEKQFRCPLCEKRFMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 47/78 (60%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 11/16 (69%)
C2H2 Zn finger 312..334 CDD:275368 15/21 (71%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
Klf9NP_034768.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..51 1/2 (50%)
COG5048 <78..234 CDD:227381 72/195 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..143 16/110 (15%)
C2H2 Zn finger 145..167 CDD:275368 15/21 (71%)
C2H2 Zn finger 175..197 CDD:275368 15/21 (71%)
C2H2 Zn finger 205..225 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.