| Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032478.2 | Gene: | Klf2 / 16598 | MGIID: | 1342772 | Length: | 354 | Species: | Mus musculus |
| Alignment Length: | 214 | Identity: | 86/214 - (40%) |
|---|---|---|---|
| Similarity: | 98/214 - (45%) | Gaps: | 59/214 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 188 GQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGGG 252
Fly 253 G----------SAFGFTTSSDSMA-----------------------------NGGYNDLSKNRK 278
Fly 279 VHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQ 343
Fly 344 LCTRSFSRSDHLSLHMRRH 362 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 54/78 (69%) |
| zf-C2H2 | 280..304 | CDD:278523 | 15/23 (65%) | ||
| C2H2 Zn finger | 282..304 | CDD:275368 | 14/21 (67%) | ||
| zf-H2C2_2 | 296..>313 | CDD:290200 | 14/16 (88%) | ||
| C2H2 Zn finger | 312..334 | CDD:275368 | 18/21 (86%) | ||
| zf-H2C2_2 | 326..351 | CDD:290200 | 18/24 (75%) | ||
| C2H2 Zn finger | 342..362 | CDD:275368 | 14/19 (74%) | ||
| Klf2 | NP_032478.2 | 9aaTAD. /evidence=ECO:0000250|UniProtKB:Q9Y5W3 | 42..50 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 52..111 | ||||
| Interaction with WWP1 | 110..267 | 22/126 (17%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..208 | 17/67 (25%) | |||
| zf-C2H2 | 271..295 | CDD:278523 | 15/23 (65%) | ||
| C2H2 Zn finger | 273..295 | CDD:275368 | 14/21 (67%) | ||
| COG5048 | <276..>353 | CDD:227381 | 59/76 (78%) | ||
| zf-C2H2 | 301..325 | CDD:278523 | 19/23 (83%) | ||
| C2H2 Zn finger | 303..325 | CDD:275368 | 18/21 (86%) | ||
| zf-H2C2_2 | 317..342 | CDD:290200 | 18/24 (75%) | ||
| C2H2 Zn finger | 333..353 | CDD:275368 | 14/19 (74%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23235 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||