DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and Klf5

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_033899.2	Gene:	Klf5 / 12224	MGIID:	1338056	Length:	446	Species:	Mus musculus

Alignment Length:	98	Identity:	75/98 - (76%)
Similarity:	81/98 - (82%)	Gaps:	6/98 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   270 YN-----DLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTR 329
            ||     ||.| |::|.||..||.||||||||||||.|||||||||.||||||.|||||||||||
Mouse   348 YNRRSNPDLEK-RRIHFCDYNGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTR 411

  Fly   330 HYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |||||||.|||:|.:|.|||||||||:|||:||
Mouse   412 HYRKHTGAKPFQCMVCQRSFSRSDHLALHMKRH 444

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	62/78 (79%)
		zf-C2H2	280..304	CDD:278523	18/23 (78%)
		C2H2 Zn finger	282..304	CDD:275368	17/21 (81%)
		zf-H2C2_2	296..>313	CDD:290200	14/16 (88%)
		C2H2 Zn finger	312..334	CDD:275368	20/21 (95%)
		zf-H2C2_2	326..351	CDD:290200	19/24 (79%)
		C2H2 Zn finger	342..362	CDD:275368	14/19 (74%)
Klf5	NP_033899.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	50..69
		9aaTAD. /evidence=ECO:0000250\|UniProtKB:Q13887	107..115
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	284..310
		Interaction with WWP1. /evidence=ECO:0000250	313..317
		COG5048	338..>422	CDD:227381	57/74 (77%)
		C2H2 Zn finger	367..386	CDD:275368	15/18 (83%)
		zf-H2C2_2	378..>395	CDD:290200	14/16 (88%)
		C2H2 Zn finger	394..416	CDD:275368	20/21 (95%)
		zf-H2C2_2	408..433	CDD:290200	19/24 (79%)
		C2H2 Zn finger	424..444	CDD:275368	14/19 (74%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3BRQ6
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910