DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf16

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_510962.2 Gene:Klf16 / 118445 MGIID:2153049 Length:251 Species:Mus musculus


Alignment Length:219 Identity:80/219 - (36%)
Similarity:112/219 - (51%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SAANSMQDYESKFSLLSLFKNPYKFAG-----GDGQAS--------RKTSPTG--GSSKPLASNS 208
            |||.:..||.:...|:::........|     |.|.|:        |:.:|.|  |:..|.|:..
Mouse     2 SAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRATRREATPPGTPGAPPPPATAP 66

  Fly   209 SPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDL 273
            .|.    ..:.:||.........:..|......:|.:     ||.|....::::.|.::|.....
Mouse    67 GPG----GATAAPHLLAASILADLRGGPVVATAASTA-----GGTSPVSSSSAASSPSSGRAPGA 122

  Fly   274 SKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVK 338
            :|:   |:|...||.|.|.||||||:|.||||||:|:.|.|.||..:|||||||.||:|.|||.|
Mouse   123 AKS---HRCPFHGCAKAYYKSSHLKSHLRTHTGERPFACDWPGCDKKFARSDELARHHRTHTGEK 184

  Fly   339 PFRCQLCTRSFSRSDHLSLHMRRH 362
            .|.|.|||:.|:|||||:.|.|||
Mouse   185 RFPCPLCTKRFTRSDHLTKHARRH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 45/78 (58%)
zf-C2H2 280..304 CDD:278523 14/23 (61%)
C2H2 Zn finger 282..304 CDD:275368 13/21 (62%)
zf-H2C2_2 296..>313 CDD:290200 11/16 (69%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 15/24 (63%)
C2H2 Zn finger 342..362 CDD:275368 12/19 (63%)
Klf16NP_510962.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..72 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..125 6/34 (18%)
COG5048 124..>186 CDD:227381 39/64 (61%)
C2H2 Zn finger 128..150 CDD:275368 13/21 (62%)
zf-H2C2_2 142..169 CDD:290200 16/26 (62%)
COG5048 <158..>231 CDD:227381 33/51 (65%)
C2H2 Zn finger 158..180 CDD:275368 14/21 (67%)
zf-H2C2_2 172..197 CDD:290200 15/24 (63%)
C2H2 Zn finger 188..208 CDD:275368 12/19 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..251 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1623
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.