DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and klf2b

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	NP_571932.1	Gene:	klf2b / 117509	ZFINID:	ZDB-GENE-011109-2	Length:	363	Species:	Danio rerio

Alignment Length:	88	Identity:	64/88 - (72%)
Similarity:	71/88 - (80%)	Gaps:	0/88 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   275 KNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKP 339
            |....|.|...||.|.||||||||||.|||||||||.|.||||.|:||||||||||:|||||.:|
Zfish   275 KRMATHTCTYAGCGKTYTKSSHLKAHHRTHTGEKPYHCNWEGCGWKFARSDELTRHFRKHTGHRP 339

  Fly   340 FRCQLCTRSFSRSDHLSLHMRRH 362
            |:|.||.|:|||||||:|||:||
Zfish   340 FQCHLCERAFSRSDHLALHMKRH 362

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	54/76 (71%)
		zf-C2H2	280..304	CDD:278523	16/23 (70%)
		C2H2 Zn finger	282..304	CDD:275368	15/21 (71%)
		zf-H2C2_2	296..>313	CDD:290200	14/16 (88%)
		C2H2 Zn finger	312..334	CDD:275368	17/21 (81%)
		zf-H2C2_2	326..351	CDD:290200	17/24 (71%)
		C2H2 Zn finger	342..362	CDD:275368	14/19 (74%)
klf2b	NP_571932.1	COG5048	<197..>362	CDD:227381	62/86 (72%)
		zf-C2H2	280..304	CDD:278523	16/23 (70%)
		C2H2 Zn finger	282..304	CDD:275368	15/21 (71%)
		C2H2 Zn finger	312..334	CDD:275368	17/21 (81%)
		zf-H2C2_2	326..351	CDD:290200	17/24 (71%)
		C2H2 Zn finger	342..362	CDD:275368	14/19 (74%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	3.010