DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf2a

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_571931.2 Gene:klf2a / 117508 ZFINID:ZDB-GENE-011109-1 Length:380 Species:Danio rerio


Alignment Length:340 Identity:112/340 - (32%)
Similarity:149/340 - (43%) Gaps:82/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AGSAGSSSLGA-----FAAQQQQQL-----YASSGVSKLPFSPF--------------------- 110
            |.:|||.:||.     :..|:.:.:     |:...::..|..|:                     
Zfish    68 ANTAGSDNLGLGMAGDYRMQESRNMYNPTTYSVPEINPSPPPPYTTSLMAELLQSDIDTYCQPSL 132

  Fly   111 ---FAASPFFFTYRRISG--------SGSGNGTGSVSVKQEDNNNSC--SYNN---GSSSGGAGS 159
               |...|.|.| :.||.        ...|...|.|...:::.|.:|  ||..   .:|..||| 
Zfish   133 QGRFLVRPAFPT-QDISECIKVEPCMDSYGPVRGMVPKVKQEGNGACMRSYEQPRLANSPQGAG- 195

  Fly   160 AANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTGGSSKPLASNSSPSWKSYAG-SGSPHA 223
               ||...:|...|::                     |...|.....::....:||.| :|.|||
Zfish   196 ---SMTPPQSPAELIN---------------------TDCQSHSQMCHALTFSQSYQGNTGFPHA 236

  Fly   224 ALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSS-----DSMANGGYNDLSKNR-KVHKC 282
            |  |....:...:|...:....|:...........|..|     |:....|.....:.| ..|.|
Zfish   237 A--PPQMQLPYQSTHHFSMCDDGLAMPNANQRVLLTPPSSPLELDAKPKRGRRTWPRKRTATHTC 299

  Fly   283 DTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTR 347
            ...||.|.||||||||||.|||||||||.|:||||.|:||||||||||:|||||.:||:|.||.|
Zfish   300 TFSGCGKTYTKSSHLKAHHRTHTGEKPYHCSWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCER 364

  Fly   348 SFSRSDHLSLHMRRH 362
            :|||||||:|||:||
Zfish   365 AFSRSDHLALHMKRH 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 54/79 (68%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 17/21 (81%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 14/19 (74%)
klf2aNP_571931.2 COG5048 <273..>364 CDD:227381 54/90 (60%)
C2H2 Zn finger 302..321 CDD:275368 14/18 (78%)
C2H2 Zn finger 329..351 CDD:275368 17/21 (81%)
zf-H2C2_2 343..368 CDD:290200 17/24 (71%)
C2H2 Zn finger 359..379 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.