DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf3

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001099212.1 Gene:Klf3 / 114845 RGDID:1593290 Length:344 Species:Rattus norvegicus


Alignment Length:375 Identity:127/375 - (33%)
Similarity:166/375 - (44%) Gaps:93/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDPLSAKEAEGPP-----VQVEPVDLSLRSPRASTSHGSSSSSYKFSSANKAVGYSNGKPGGSSG 68
            |.||..|..:.|.     :|:|||||::....:..|...|.||.||.|..:|      .||.|..
  Rat    39 STPLPDKFFQTPEGLAHGIQMEPVDLTVNKRGSPPSAAGSPSSLKFPSHRRA------SPGLSMP 97

  Fly    69 SSSS--SGFGAGSAGSSSLG-------AFAAQQQQQLYASSGVSKLPFSPFFAASPFFFTYRRIS 124
            |||.  ..:...|.|....|       ..||...:....|.|:  ||........|..|.|    
  Rat    98 SSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALTRHGIRSPGI--LPVIQPVVVQPVPFMY---- 156

  Fly   125 GSGSGNGTG------SVSVKQE-DNNNSCSYNNGSSSGGAGSAANSMQDYESKFSLLSLFKNPYK 182
                   |.      .||:.:| ||:||            |.....::.||.     .:.:...|
  Rat   157 -------TSHLQQPLMVSLSEEMDNSNS------------GMPVPVIESYEK-----PILQKKIK 197

  Fly   183 FAGGDGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFSGI 247
            ...|. :..|........|.||.::.||. ::......|...:.|     |:.....::.     
  Rat   198 IEPGI-EPQRTDYYPEEMSPPLMNSVSPP-QALLQENHPSVIVQP-----GKRPLPVESP----- 250

  Fly   248 NFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVC 312
                                    |..:.|::|:||.:||:||||||||||||:|||||||||.|
  Rat   251 ------------------------DTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKC 291

  Fly   313 TWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |||||.|:||||||||||:|||||:|||:|..|.|||||||||:||.:||
  Rat   292 TWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 58/78 (74%)
zf-C2H2 280..304 CDD:278523 18/23 (78%)
C2H2 Zn finger 282..304 CDD:275368 17/21 (81%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 18/21 (86%)
zf-H2C2_2 326..351 CDD:290200 18/24 (75%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
Klf3NP_001099212.1 COG5048 <169..>331 CDD:227381 78/214 (36%)
zf-C2H2 259..283 CDD:278523 18/23 (78%)
C2H2 Zn finger 261..283 CDD:275368 17/21 (81%)
zf-H2C2_2 275..>292 CDD:290200 14/16 (88%)
C2H2 Zn finger 291..313 CDD:275368 18/21 (86%)
zf-H2C2_2 305..330 CDD:290200 18/24 (75%)
C2H2 Zn finger 321..341 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I10957
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3957
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 1 1.000 - - otm45002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
99.020

Return to query results.
Submit another query.