DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and KLF1

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_006554.1 Gene:KLF1 / 10661 HGNCID:6345 Length:362 Species:Homo sapiens


Alignment Length:401 Identity:128/401 - (31%)
Similarity:165/401 - (41%) Gaps:124/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AKEAE----GPPVQVEP-------------------------VDLSLR---------SPRASTSH 40
            ::||:    |||...||                         :||.|.         :|:.....
Human    33 SEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALA 97

  Fly    41 GSSSSSYKFSSANKAVGYSNGKPG---GSSGSSSSSGFGAGSAGSSSLGAFAAQQQQQLYASSGV 102
            .|.:|..::....:.:|...|.||   |..||...||:...:..:.:..||..       .:...
Human    98 PSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVG-------PALAP 155

  Fly   103 SKLPFSPFFAASPFFFTYRRISGSGSGNGTG-----SVSVKQEDNNNSCSYNNGSSSG---GAGS 159
            :..|.....|..|.:      .|.|:|:..|     .:||.             ::||   |..|
Human   156 APAPEPKALALQPVY------PGPGAGSSGGYFPRTGLSVP-------------AASGAPYGLLS 201

  Fly   160 AANSM---QDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSP 221
            ...:|   ..|:..|.|         |.|..|       |..|.:      :|||:.|..|.|:.
Human   202 GYPAMYPAPQYQGHFQL---------FRGLQG-------PAPGPA------TSPSFLSCLGPGTV 244

  Fly   222 HAALNPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEG 286
                     |.|.|.|.:|.               |....:.....|..:...|.:..|.|...|
Human   245 ---------GTGLGGTAEDP---------------GVIAETAPSKRGRRSWARKRQAAHTCAHPG 285

  Fly   287 CDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSR 351
            |.|.||||||||||.|||||||||.||||||.||||||||||||||||||.:|||||||.|:|||
Human   286 CGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSR 350

  Fly   352 SDHLSLHMRRH 362
            ||||:|||:||
Human   351 SDHLALHMKRH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 59/78 (76%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 20/21 (95%)
zf-H2C2_2 326..351 CDD:290200 20/24 (83%)
C2H2 Zn finger 342..362 CDD:275368 15/19 (79%)
KLF1NP_006554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..110 13/76 (17%)
EKLF_TAD1 22..>42 CDD:293437 2/8 (25%)
EKLF_TAD2 59..85 CDD:293438 3/25 (12%)
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 71..79 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271 5/36 (14%)
zf-C2H2 279..303 CDD:278523 16/23 (70%)
COG5048 <281..>361 CDD:227381 65/79 (82%)
C2H2 Zn finger 284..303 CDD:275368 14/18 (78%)
zf-H2C2_2 295..322 CDD:290200 23/26 (88%)
C2H2 Zn finger 311..333 CDD:275368 20/21 (95%)
zf-H2C2_2 325..350 CDD:290200 20/24 (83%)
C2H2 Zn finger 341..361 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.