DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf9

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001107146.1 Gene:klf9 / 100134994 XenbaseID:XB-GENE-483889 Length:289 Species:Xenopus tropicalis


Alignment Length:206 Identity:79/206 - (38%)
Similarity:98/206 - (47%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PTGGSSKPLASNSSPSWKSYAGSGSPHAAL----------NPAFGGMGRG-ATRKDNSSFSGINF 249
            |..|.:|........:||.|....:...:|          :||:...... .:..|.::.||::|
 Frog    65 PEPGPNKEHHDGPGEAWKDYCTLLTIAKSLLELNKYRPLPSPAYSHSDEELCSDSDVTTESGLSF 129

  Fly   250 G---GGGSAFGFTTSSD---SMANGGYNDL----------------------SKNRKVHKCDTEG 286
            .   ..||....||.|.   |...|....|                      |.|.|.|:|...|
 Frog   130 SPSHSPGSCSSSTTPSHMDYSPEPGSTQPLPLTQDAPKSPTRPLGKDTAPVRSTNEKRHRCPYAG 194

  Fly   287 CDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSR 351
            |.|||.||||||||.|.||||:|:.|||..|:.:|:||||||||||.|||.|.|||.||.:.|.|
 Frog   195 CGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMR 259

  Fly   352 SDHLSLHMRRH 362
            ||||:.|.|||
 Frog   260 SDHLTKHARRH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 50/100 (50%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 11/16 (69%)
C2H2 Zn finger 312..334 CDD:275368 15/21 (71%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 11/19 (58%)
klf9NP_001107146.1 SFP1 <184..272 CDD:227516 57/87 (66%)
C2H2 Zn finger 190..212 CDD:275368 15/21 (71%)
C2H2 Zn finger 220..242 CDD:275368 15/21 (71%)
zf-H2C2_2 234..257 CDD:372612 16/22 (73%)
C2H2 Zn finger 250..270 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.