Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107146.1 | Gene: | klf9 / 100134994 | XenbaseID: | XB-GENE-483889 | Length: | 289 | Species: | Xenopus tropicalis |
Alignment Length: | 206 | Identity: | 79/206 - (38%) |
---|---|---|---|
Similarity: | 98/206 - (47%) | Gaps: | 39/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 PTGGSSKPLASNSSPSWKSYAGSGSPHAAL----------NPAFGGMGRG-ATRKDNSSFSGINF 249
Fly 250 G---GGGSAFGFTTSSD---SMANGGYNDL----------------------SKNRKVHKCDTEG 286
Fly 287 CDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSR 351
Fly 352 SDHLSLHMRRH 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 50/100 (50%) |
zf-C2H2 | 280..304 | CDD:278523 | 16/23 (70%) | ||
C2H2 Zn finger | 282..304 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 296..>313 | CDD:290200 | 11/16 (69%) | ||
C2H2 Zn finger | 312..334 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 326..351 | CDD:290200 | 17/24 (71%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 11/19 (58%) | ||
klf9 | NP_001107146.1 | SFP1 | <184..272 | CDD:227516 | 57/87 (66%) |
C2H2 Zn finger | 190..212 | CDD:275368 | 15/21 (71%) | ||
C2H2 Zn finger | 220..242 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 234..257 | CDD:372612 | 16/22 (73%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 11/19 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |