Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093690.1 | Gene: | klf13 / 100101699 | XenbaseID: | XB-GENE-479837 | Length: | 258 | Species: | Xenopus tropicalis |
Alignment Length: | 211 | Identity: | 79/211 - (37%) |
---|---|---|---|
Similarity: | 95/211 - (45%) | Gaps: | 60/211 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 TSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSF-------------- 244
Fly 245 --------SGINF-----------GGGGSAFGFTT-------SSDSMANGGYN--DLSKNRKVHK 281
Fly 282 CDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCT 346
Fly 347 RSFSRSDHLSLHMRRH 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 46/78 (59%) |
zf-C2H2 | 280..304 | CDD:278523 | 17/23 (74%) | ||
C2H2 Zn finger | 282..304 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 296..>313 | CDD:290200 | 12/16 (75%) | ||
C2H2 Zn finger | 312..334 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 326..351 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 10/19 (53%) | ||
klf13 | NP_001093690.1 | COG5048 | <131..230 | CDD:227381 | 55/88 (63%) |
C2H2 Zn finger | 138..160 | CDD:275368 | 15/21 (71%) | ||
C2H2 Zn finger | 168..190 | CDD:275368 | 14/21 (67%) | ||
C2H2 Zn finger | 198..218 | CDD:275368 | 10/19 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000436 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |