DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and klf13

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001093690.1 Gene:klf13 / 100101699 XenbaseID:XB-GENE-479837 Length:258 Species:Xenopus tropicalis


Alignment Length:211 Identity:79/211 - (37%)
Similarity:95/211 - (45%) Gaps:60/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 TSPTGGSSKPLASNSSPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSF-------------- 244
            |:|.|          ||..||...|.:|..|  |.      |..|::|:|.              
 Frog    26 TAPIG----------SPDGKSQGSSAAPPPA--PP------GEDRRENASLFVVARILADLNQQA 72

  Fly   245 --------SGINF-----------GGGGSAFGFTT-------SSDSMANGGYN--DLSKNRKVHK 281
                    .||:.           ..|..|....|       |....|..|.:  |.....|.||
 Frog    73 PKPGEKAECGISLLPAGNEADREPPAGKRADRAATPPLLPEPSPKQRARRGKSRCDPESPLKKHK 137

  Fly   282 CDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCT 346
            |...||:|||.||||||||.||||||:|:.|:|:.|..:|||||||.||||.|||.|.|.|.:|.
 Frog   138 CPYSGCEKVYGKSSHLKAHLRTHTGERPFECSWDECNKKFARSDELARHYRTHTGEKKFSCPICE 202

  Fly   347 RSFSRSDHLSLHMRRH 362
            :.|.|||||:.|.|||
 Frog   203 KRFMRSDHLTKHARRH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 46/78 (59%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
zf-H2C2_2 296..>313 CDD:290200 12/16 (75%)
C2H2 Zn finger 312..334 CDD:275368 14/21 (67%)
zf-H2C2_2 326..351 CDD:290200 14/24 (58%)
C2H2 Zn finger 342..362 CDD:275368 10/19 (53%)
klf13NP_001093690.1 COG5048 <131..230 CDD:227381 55/88 (63%)
C2H2 Zn finger 138..160 CDD:275368 15/21 (71%)
C2H2 Zn finger 168..190 CDD:275368 14/21 (67%)
C2H2 Zn finger 198..218 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.