DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9896 and CG13408

DIOPT Version :9

Sequence 1:NP_611745.1 Gene:CG9896 / 37652 FlyBaseID:FBgn0034808 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651007.1 Gene:CG13408 / 42597 FlyBaseID:FBgn0038929 Length:257 Species:Drosophila melanogaster


Alignment Length:201 Identity:47/201 - (23%)
Similarity:83/201 - (41%) Gaps:25/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVFSALLLL--------------SAEVANSEECG--QEEFTKCAE--PLDMLHLTSDFSIGPAK 59
            |:.|..||.|              |......||||  |:...:|.:  |..::....:..|..:|
  Fly    12 LIYFVILLRLVNLVLAQNEGNISESTVATGREECGSTQKMVDECFKDLPPHLMDFLQNTKIVISK 76

  Fly    60 KEELEKLCHELRKGVRCIQSYTRRCMDLQQRNQFNKLYHDTNQFIRDLCNKGAFQDEYLKHVPCS 124
            ||...| |:...:|:||..:|::||:|.::...|........:|....|....||.:||:|..|.
  Fly    77 KEITAK-CNIFNRGMRCFDTYSKRCLDDRKMGTFKNNVEGARRFFYKFCGDADFQRDYLRHKDCF 140

  Fly   125 EMAKKEFEVCSNRYRETMVFLKPNKNQENSENGTLNENIKTICCSINELVDCSEDAARKICGNEA 189
            ...:.::..|:..:...:      ..:.:.|....:|.....||:.....:|..::||..|...:
  Fly   141 AYIQLDWVTCTTEFENIL------SEEVHDERRNASEKFLEFCCARYAYENCIYNSARFKCYKNS 199

  Fly   190 AKFTRQ 195
            |:|.|:
  Fly   200 AEFARE 205



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4142
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.