DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9896 and F53A2.1

DIOPT Version :9

Sequence 1:NP_611745.1 Gene:CG9896 / 37652 FlyBaseID:FBgn0034808 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_499746.2 Gene:F53A2.1 / 186137 WormBaseID:WBGene00009949 Length:403 Species:Caenorhabditis elegans


Alignment Length:269 Identity:57/269 - (21%)
Similarity:97/269 - (36%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WSW--TLLVFSALLLLSAEVANS--EECGQ--EEFTKCAEPLDM----LHLTSDFSIGPAKKEEL 63
            ||:  .||:...|........||  :||.|  .::.|.....|.    ....|.||:........
 Worm    96 WSYLVILLIPGVLSTTCPHSVNSKIQECVQPVADYAKVLNNQDSRTSGSEFGSAFSLPNMGGRVF 160

  Fly    64 EKLCHELRKGVRCIQSYTRRCMDLQQRNQFNKLYHDTNQFIRD----LCNKGAFQDEYLKHVPC- 123
            .:||..:.|...|::.|...|.           .|.|...|..    |||:|  .:.:::...| 
 Worm   161 NELCRLIAKFNSCVRDYRSTCP-----------RHVTISLIDSSYGYLCNEG--YNTFMESAECL 212

  Fly   124 SEMAKK-EFEVCSNRYRETMVFLKPNKNQENSENG-TLNENIKTICCSINELVDCSEDAARKICG 186
            .|:.:| ..:.|   :.||:..::    ..|:|:| ::...:..:|.::|....|.....::.||
 Worm   213 MELDRKPSVKRC---HDETLKEIE----SANTESGVSMPAKVDRMCGALNFFSGCVRSPIKQDCG 270

  Fly   187 NEAAKFTRQLVDKYANSLTKIYCEDFTRNPGICRDGEGNGSTRAAGSSLGLL-----------LT 240
            ..|.:...:::....|:|... |: ||                  |:|..||           :|
 Worm   271 FSAWQVIYRVLKDTTNTLMPA-CQ-FT------------------GTSQKLLSFQKEIDSLNNVT 315

  Fly   241 GTLLTLLVS 249
            .|..||..|
 Worm   316 STTTTLQTS 324



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.