DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9897 and KLK10

DIOPT Version :10

Sequence 1:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002767.2 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:166 Identity:38/166 - (22%)
Similarity:60/166 - (36%) Gaps:51/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 STVSLSCPYPTCCSWWKTLANEPRAILGYSDGSICVVGLMPNCSFLGDTNCERGSIEKLIICQDN 339
            |...|...:|.|.|     ...|..:.|...||:.|     .|.:     ..|....|...|:..
Human     4 SPALLLLSFPGCLS-----IQGPALVRGPEQGSVTV-----QCRY-----SSRWQTNKKWWCRGA 53

  Fly   340 SMETISLMINTSTKEQWKLLLEQKSIKYTFPGAITPTSVQD--------LKSELLKSLSSD---- 392
            |..|..::|.::..|:     |.||      |.:   |::|        :..|:|:...:|    
Human    54 SWSTCRVLIRSTGSEK-----ETKS------GRL---SIRDNQKNHSFQVTMEMLRQNDTDTYWC 104

  Fly   393 ---GTGSESGS-VPIEDWQIVLSLPKDGETASGSQQ 424
               ..|::.|: |.:.    |.|:.||  |.|.|.|
Human   105 GIEKFGTDRGTRVKVN----VYSVGKD--TMSTSNQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473
KLK10NP_002767.2 Tryp_SPc 49..272 CDD:238113 25/106 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.