DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A1 and CG11391

DIOPT Version :9

Sequence 1:XP_011526302.1 Gene:SLC27A1 / 376497 HGNCID:10995 Length:658 Species:Homo sapiens
Sequence 2:NP_650830.1 Gene:CG11391 / 42353 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster


Alignment Length:563 Identity:129/563 - (22%)
Similarity:223/563 - (39%) Gaps:93/563 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    77 TIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGF-APGDVVAIFLEGRPE 140
            |:.:|....:||||:|:..:........|..|:...:..:....|..|| ...|:|.:.......
  Fly    33 TVGQIIFRQLQRQPQRIFQISHTDNTRLTRFQMLQNAAKIGCYLRDQGFKKETDLVGLMARNSTH 97

Human   141 FVGLWLGLAKAGMEAALLNVNLRR----------EPLAFCLGTSG-AKALIFGGEMVAAVAEVSG 194
            ...|..|....|.....:|.||..          .|...|..|:. .|....|..:.|.:..|:|
  Fly    98 VGALAYGCLFNGTPFHAVNPNLEHNTISSLYKITRPRILCCDTADYEKIKDIGASLGALIITVNG 162

Human   195 HLGKSLIKFCSGDLGPEGILPDTHLL-DPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKA 258
            .|              .|::....:| :||..:...|..    .:|:|..:..:.:|||||.|||
  Fly   163 KL--------------PGVISVADILQNPLPDDYEPAQF----QRGVDRTMAILCSSGTTGTPKA 209

Human   259 AIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFW 323
            ..:.:||    ..|..|:| :.:.||.|....|....|.|..|...:...:.::..:.||.:.|.
  Fly   210 VTLSNSR----KLFEMHSY-LGSDDVQYAPSTLDWLTGLITLVTAAVFGTVRLISSEMFSTAHFL 269

Human   324 DDCIKY--NCTINGVRHCRLLCLVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAI--WE 384
            |.|.::  :.||....|..:|.        .|.....|.:|..:   .:..|.|:.|...:  .:
  Fly   270 DICEQHEVSWTIMANSHVAMLA--------NCPKTSAQKLRSLK---HLLFAGGHCLVATLKKMQ 323

Human   385 EFTERFGVRQIGEFYGATECNCSIA-NMD--GKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRD 446
            .|....|:  :...||.||....:: |.|  .|..|.|   |::.:: .:::|    |:...|:.
  Fly   324 SFLHGSGI--LRNAYGLTEVGTLVSYNYDTQSKPTSVG---RLMANI-RVKIV----DSSGQLQG 378

Human   447 AQGLC-IPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSA--YLSGDVLVM 508
            .:||. |.|..|:|               :.|||.....:.::.       |||  |.:|||...
  Fly   379 PKGLGEILCHNGQP---------------WSGYVGNPLATAEMR-------DSAGWYHTGDVGYF 421

Human   509 DELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVA-DPH 572
            ||..|::..:|..|..::.|......|||.|::::....:|.|:|: ....||.|..|:|. ...
  Fly   422 DEDHYLHIVERKKDMLKYLGMMYYPHEVEEVIAQMPDVAEVCVFGI-FRETEGDAAAASVVLRSG 485

Human   573 SLLDPNAIYQELQKVLAPYARPIF--LRLLPQVDTTGTFKIQK 613
            |.|||..:.|.::|.::...:.:.  ::.:||:..:...|:.:
  Fly   486 SKLDPKHVEQYVRKNVSVQFKHLHGGVQFVPQLAKSANGKVNR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A1XP_011526302.1 PRK08279 42..656 CDD:236217 129/563 (23%)
metallo-hydrolase-like_MBL-fold 64..>135 CDD:304873 14/58 (24%)
AFD_class_I 101..623 CDD:302604 122/539 (23%)
CG11391NP_650830.1 CaiC 24..541 CDD:223395 129/563 (23%)
AFD_class_I 51..527 CDD:302604 122/542 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.