DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A1 and CG11659

DIOPT Version :9

Sequence 1:XP_011526302.1 Gene:SLC27A1 / 376497 HGNCID:10995 Length:658 Species:Homo sapiens
Sequence 2:NP_650829.1 Gene:CG11659 / 42352 FlyBaseID:FBgn0038731 Length:546 Species:Drosophila melanogaster


Alignment Length:535 Identity:117/535 - (21%)
Similarity:185/535 - (34%) Gaps:150/535 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    86 VQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAK 150
            ::|.|:..|.:.|..|...|..:|.|.:..:|:..|.||....|:|.:........:.:......
  Fly    39 MRRHPQLTAQISATEGTVLTRGELLANAMRLASYMRSLGLLQSDIVGLIGRNTTHMLAVAYACFF 103

Human   151 AGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGD-------- 207
            .|:....||:...|:.:                |.:..|...|       |.||.||        
  Fly   104 NGIAFHSLNITYDRDTI----------------EKIYKVTRPS-------IIFCDGDEFEKVRSA 145

Human   208 ---LGPEGILPDTHLLDPL-LKEASTAPL------AQIPSKGMDDRLFYIYTSGTTGLPKAAIVV 262
               |..:.:....|.||.: :.|....|:      |:: .||.|..|..:.:|||||.|||..:.
  Fly   146 TAELDVKIVTMRNHPLDSIKIDEVVATPIEENFQPAKL-EKGNDQTLAILCSSGTTGTPKAVTIT 209

Human   263 HSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDD-- 325
            :||:  :.|..:|   :..|||.|.    :::...|.|:       ||.:....||.:|...|  
  Fly   210 NSRH--ILAGNYH---LTTADVQYS----HNTLDWITGL-------LTTITSGVFSTTRIIADNA 258

Human   326 -------------------------CIKYNCTINGVRHCRLLCLVVQYIGEICRYLLKQPVREAE 365
                                     .:..||.  ....|.|..|.....|               
  Fly   259 FDPAFALRIIEEYKVTWTIQPPSSMALMINCP--DFETCDLSSLRCYMFG--------------- 306

Human   366 RRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATE------CNCSIANMDGKVGSCGFNSRI 424
             ..|..|.|..|:|        .|.....:...||.||      .||   :.|.|.||.|     
  Fly   307 -GSRAALEVQKGIR--------SRLSHNCLQFVYGFTELGAMATINC---HFDEKTGSVG----- 354

Human   425 LPHVYPIRLVKVNEDTMELLRDAQG-LCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKI 488
             ..|..:::...|:|...|..|..| :||             :|.|    .:.||......::.:
  Fly   355 -QLVNGLKMKIKNDDGESLGPDEIGEVCI-------------MNNQ----HWSGYYGNEVETRNM 401

Human   489 AHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYG 553
            ..|:     ..|.|||:..||..|::|..||..:..:::.......::|.|:|.:....:|.|:|
  Fly   402 RDSL-----GWYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVISEMPQVAEVCVFG 461

Human   554 VAVPGVEGKAGMAAV 568
            : ...:.|....|||
  Fly   462 I-WSNIFGDEAAAAV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A1XP_011526302.1 PRK08279 42..656 CDD:236217 117/535 (22%)
metallo-hydrolase-like_MBL-fold 64..>135 CDD:304873 14/48 (29%)
AFD_class_I 101..623 CDD:302604 113/520 (22%)
CG11659NP_650829.1 CaiC 26..523 CDD:223395 117/535 (22%)
AFD_class_I 47..522 CDD:302604 115/527 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.