DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A1 and CG18586

DIOPT Version :9

Sequence 1:XP_011526302.1 Gene:SLC27A1 / 376497 HGNCID:10995 Length:658 Species:Homo sapiens
Sequence 2:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster


Alignment Length:537 Identity:110/537 - (20%)
Similarity:192/537 - (35%) Gaps:163/537 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   110 DAYSNA--VANLFRQLGFAPGDVV---------------AIFLEGRPEFVGLWLGLAKAGMEAAL 157
            |.:.||  ||:..|.:|....|:|               |.|..|.|..     .|..|..||.:
  Fly    69 DLHMNAMRVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLH-----ALHNAYEEACI 128

Human   158 LNV-NLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLD 221
            ..: .:.:..|.||.|....|......::...:..:..|              |.|.:       
  Fly   129 AKLFGITKPRLIFCDGDEYEKVKSATKDLQVTIVTMRNH--------------PRGSV------- 172

Human   222 PLLKEASTAPLAQ--IPSK---GMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQA 281
             .:::..|.|:.|  .|.:   |:|..|..:.:|||:|.|||..:.:|.                
  Fly   173 -RIQDVLTTPVMQNFQPLRLKDGIDHTLAILSSSGTSGFPKAVTISNSH---------------- 220

Human   282 ADVLYDCLPLYHSAGNIIGVGQCLIY--GLTVVLRK-KFSASRFWDDCIKYN----CTINGVRHC 339
             .::.|.:.:.:|  ||......|.:  ||::.:.. .||.:....|| .::    |...|....
  Fly   221 -KIIVDYMAINNS--NIQYTSSTLDWCSGLSMAITSGVFSTTSIIADC-DFDPGLFCRAIGKYRI 281

Human   340 RLLCLVVQYI-----------------------GEICRYLLKQPVREAERRHRVRLAVGNGLRPA 381
            .::.|...|:                       |..|..       |.:|:.|.||:        
  Fly   282 SMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSL-------EVQRKVRSRLS-------- 331

Human   382 IWEEFTERFGVRQIGEF-YGATECNCSIA---NMDGKVGSCGFNSRILPHVYPIRLVKVNEDTME 442
                       .....| ||.||.|.:.:   |.|.|..|.|         ..||.:|:.     
  Fly   332 -----------HDCLNFCYGLTELNSAGSVNLNFDEKPNSVG---------RAIRGIKIK----- 371

Human   443 LLRDAQGLCIPCQAGEPGLLVGQI---NQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGD 504
             :.|.||     :|.||. :||:|   |.|    ::.||......:::|..|     ::...:||
  Fly   372 -VIDEQG-----EAQEPN-VVGEICFHNSQ----KWAGYYKNPDETRQIQDS-----ENWIHTGD 420

Human   505 VLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVA 569
            :..:|:.||::..||..|..:::......:|:|.|::.:....:..|:|:..|....:|..:.|.
  Fly   421 LGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVK 485

Human   570 DPHSLLDPNAIYQELQK 586
            .|.:.|:...:.:.::|
  Fly   486 KPGTQLEAQDVVEYVRK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A1XP_011526302.1 PRK08279 42..656 CDD:236217 110/537 (20%)
metallo-hydrolase-like_MBL-fold 64..>135 CDD:304873 10/41 (24%)
AFD_class_I 101..623 CDD:302604 110/537 (20%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 110/537 (20%)
AFD_class_I 55..530 CDD:302604 110/537 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.