DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A1 and CG5568

DIOPT Version :9

Sequence 1:XP_011526302.1 Gene:SLC27A1 / 376497 HGNCID:10995 Length:658 Species:Homo sapiens
Sequence 2:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster


Alignment Length:567 Identity:122/567 - (21%)
Similarity:197/567 - (34%) Gaps:171/567 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    85 VVQRQPERLALVDA------GTGECWTFAQLDAYSNAVANLFRQLGFAPGDVV------------ 131
            ::.:|.||.|::.|      .|...|...|.:|..  ||:..|:||...||.|            
  Fly    42 IIFQQMERNAMLTAQISVTENTELTWKDIQTNAMK--VASYMRKLGLEQGDFVGVIGRLTTHLTA 104

Human   132 ---AIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVS 193
               |.|..|.| :..|.....::.:|...   .:.:..|.||.|....|.......:...:..:.
  Fly   105 LAYACFFNGTP-YHALHTEYEQSAIERLF---GITKPRLIFCDGDEFEKVQAATKGLQVQIVTMR 165

Human   194 GHLGKSLIKFCSGDLGPEGILPDTHLL-DPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPK 257
            .|              |.|||....:| .|:  |.:..|:..  ..|.|..|..:.:|||:||||
  Fly   166 NH--------------PAGILRIQDILTTPV--EMNFRPVRL--KDGTDQLLAILSSSGTSGLPK 212

Human   258 AAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIY----------GLTVV 312
            |..:.:|                           :...|:.:.|...:|.          |:|:.
  Fly   213 AVTISNS---------------------------HQIIGSFLPVDSSIIQYNPNTLDWASGITMT 250

Human   313 LRKK-FSASRFWDDC-----------IKYNCTINGVRHCRLLCL------------VVQYI---G 350
            :... ||.:...:||           .||..::..|...:|..|            .|:|.   |
  Fly   251 INAAVFSLTSIIEDCDFDPANLCGLIEKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYGG 315

Human   351 EICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECN---CSIANMD 412
            ..|                 .|.|.|.:|..:..|.        :...|..||.|   |...|.|
  Fly   316 SNC-----------------SLEVQNKIRSRLSNEC--------VNFSYTLTELNSPGCLNFNFD 355

Human   413 GKVGSCGFNSRILPHVYPIRLVK---VNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRR 474
            .|..|.|         .|:|.::   |||     |.:|||   |...||.....||        :
  Fly   356 EKPNSVG---------RPVRGIQIKIVNE-----LGEAQG---PNVVGEICFNNGQ--------K 395

Human   475 FDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGV 539
            :.||......:||:..|     ::.:.:||:..|||.||::..||..|..:::......:|:|.|
  Fly   396 WPGYYKNPEETKKMQDS-----ENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIESV 455

Human   540 LSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQK 586
            ::.:....:..|:|:..|....||..:.|....:.|:...:.:.::|
  Fly   456 IAEMPNVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVRK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A1XP_011526302.1 PRK08279 42..656 CDD:236217 122/567 (22%)
metallo-hydrolase-like_MBL-fold 64..>135 CDD:304873 18/70 (26%)
AFD_class_I 101..623 CDD:302604 116/545 (21%)
CG5568NP_647992.1 CaiC 35..540 CDD:223395 122/567 (22%)
Firefly_Luc_like 55..530 CDD:213279 118/554 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.