DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9849 and SPPL3

DIOPT Version :10

Sequence 1:NP_611740.1 Gene:CG9849 / 37647 FlyBaseID:FBgn0034803 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001325362.1 Gene:SPPL3 / 818909 AraportID:AT2G43070 Length:605 Species:Arabidopsis thaliana


Alignment Length:133 Identity:36/133 - (27%)
Similarity:60/133 - (45%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FGSAF---SERLEGVPLVITDPPGACQEIRNARDLNGGVALIDRGECSFLTKTLRAEAAGALAAI 119
            ||:|.   .::....|....||..:|..:.:.  |:|.:||..||.|:|..|...||||||.|.:
plant   131 FGAALPSVPDQALRFPAAFVDPLDSCSHLSSR--LDGHIALSIRGNCAFTEKAKHAEAAGASALL 193

  Fly   120 ITEYNPSSPEFEHYIEM--IHDNSQQDANIPAGFLLGKNGVIIRSTLQRLKRVHALINIP----V 178
            :..      :.|...||  :..::..:.:||...:...:|..:..::...|.|..|:..|    |
plant   194 VIN------DKEDLDEMGCMEKDTSLNVSIPVLMISKSSGDALNKSMVDNKNVELLLYAPKRPAV 252

  Fly   179 NLT 181
            :||
plant   253 DLT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9849NP_611740.1 PA_hPAP21_like 57..176 CDD:239042 32/122 (26%)
SPPL3NP_001325362.1 PA_GO-like 106..244 CDD:239047 31/120 (26%)
Peptidase_A22B 309..589 CDD:282158
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.