DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and ZCCHC3

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_149080.2 Gene:ZCCHC3 / 85364 HGNCID:16230 Length:403 Species:Homo sapiens


Alignment Length:131 Identity:36/131 - (27%)
Similarity:51/131 - (38%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKCNRPGHFARDCSLGGGGG-----PGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFA 67
            |||        :..|..|.|     ||....|...|....:|..        :.|:||....|.:
Human   297 YKC--------EIELRQGEGGVRHLPGAFFLGAERGYSWYKGQP--------KTCFKCGSRTHMS 345

  Fly    68 RACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTG 132
            .:|.:  :||:||...||:|..|.:  ...|..|.|.||....||:||:    .:|:.......|
Human   346 GSCTQ--DRCFRCGEEGHLSPYCRK--GIVCNLCGKRGHAFAQCPKAVH----NSVAAQLTGVAG 402

  Fly   133 H 133
            |
Human   403 H 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 36/131 (27%)
ZCCHC3NP_149080.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158
AIR1 <333..>386 CDD:331526 18/56 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.