DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AIR2

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_010106.1 Gene:AIR2 / 851379 SGDID:S000002334 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:149 Identity:41/149 - (27%)
Similarity:57/149 - (38%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGI-GHISKDCTQADNPTC 98
            |.|...|:..:|...::....||..|:|.||..:.||...  |..|... .|.|:.|.:|..  |
Yeast    41 GQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHII--CSYCGATDDHYSRHCPKAIQ--C 101

  Fly    99 YRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCP------------ETSKT------- 144
            .:|::.||:...||....:     |.|..|....|..:.||            |.:|.       
Yeast   102 SKCDEVGHYRSQCPHKWKK-----VQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHT 161

  Fly   145 --CYGCGKSGHLRRECDEK 161
              ||.||..||...:|.||
Yeast   162 IYCYNCGGKGHFGDDCKEK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 39/147 (27%)
AIR2NP_010106.1 AIR1 1..209 CDD:227414 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1052
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.