DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT1G75560

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001077828.1 Gene:AT1G75560 / 843892 AraportID:AT1G75560 Length:257 Species:Arabidopsis thaliana


Alignment Length:157 Identity:48/157 - (30%)
Similarity:67/157 - (42%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHF 66
            |....|..|.||||||||||                               |...|..|...||.
plant    52 SQGNLCNNCKRPGHFARDCS-------------------------------NVSVCNNCGLPGHI 85

  Fly    67 ARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRT 131
            |..|..|: ||:.|...||::.:|  ::...|:.|.|:||..|:|..:.:..|...: |..|.:.
plant    86 AAECTAES-RCWNCREPGHVASNC--SNEGICHSCGKSGHRARDCSNSDSRAGDLRL-CNNCFKQ 146

  Fly   132 GHISKNCPETSKTCYGCGKSGHLRREC 158
            ||::.:| ...|.|..|..|||:.|:|
plant   147 GHLAADC-TNDKACKNCRTSGHIARDC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 47/153 (31%)
AT1G75560NP_001077828.1 PTZ00368 55..172 CDD:173561 46/152 (30%)
PTZ00368 114..247 CDD:173561 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101988
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.