DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and ZCCHC9

DIOPT Version :10

Sequence 1:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_115656.1 Gene:ZCCHC9 / 84240 HGNCID:25424 Length:271 Species:Homo sapiens


Alignment Length:122 Identity:34/122 - (27%)
Similarity:48/122 - (39%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAV 115
            ::|...|:.|.:.||....||...|......||              ||||..|.|.:..|...|
Human   124 KKNAMVCFHCRKPGHGIADCPAALENQDMGTGI--------------CYRCGSTEHEITKCKAKV 174

  Fly   116 NERGPT-----NVSCYKCNRTGHISKNCPETSKTCYG-------CGKSGHLRRECDE 160
            :   |.     ...|:.|...||:|::||:..|..|.       ||...||:::|.|
Human   175 D---PALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_611739.1 PTZ00368 6..161 CDD:173561 34/122 (28%)
ZCCHC9NP_115656.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
PTZ00368 <130..229 CDD:173561 33/116 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.