DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CNBP and ZCCHC7

DIOPT Version :9

Sequence 1:	NP_001188992.1	Gene:	CNBP / 37646	FlyBaseID:	FBgn0034802	Length:	165	Species:	Drosophila melanogaster
Sequence 2:	NP_001276048.1	Gene:	ZCCHC7 / 84186	HGNCID:	26209	Length:	543	Species:	Homo sapiens

Alignment Length:	135	Identity:	33/135 - (24%)
Similarity:	51/135 - (37%)	Gaps:	41/135 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 CYKCNQFGHFARAC--PEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNE-- 117
            |..|::.||.::.|  |.:..||:.|:..||:...|..   |.|..|        ..|:.::.
Human   243 CRNCDKRGHLSKNCPLPRKVRRCFLCSRRGHLLYSCPA---PLCEYC--------PVPKMLDHSC 296

  Fly   118 --RGPTNVSCYKCNRTGHISKNC---------------PETSKT---------CYGCGKSGHLRR 156
              |...:..|.:|:..||.:..|               |:..||         ||.|.:.||...
Human   297 LFRHSWDKQCDRCHMLGHYTDACTEIWRQYHLTTKPGPPKKPKTPSRPSALAYCYHCAQKGHYGH 361

  Fly   157 ECDEK 161
            ||.|:
Human   362 ECPER 366

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CNBP	NP_001188992.1	PTZ00368	6..161	CDD:173561	32/133 (24%)
ZCCHC7	NP_001276048.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	51..71
		AIR1	<238..379	CDD:227414	33/135 (24%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	414..543
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5082
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1535084at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.820