DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Lin28a

DIOPT Version :10

Sequence 1:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_665832.1 Gene:Lin28a / 83557 MGIID:1890546 Length:209 Species:Mus musculus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:47/135 - (34%) Gaps:49/135 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCT 91
            |||||     ...|..|...|..|::.|.|                 .:|||.|.|:.|.:|:|.
Mouse   111 GPGGV-----FCIGSERRPKGKNMQKRRSK-----------------GDRCYNCGGLDHHAKECK 153

  Fly    92 QADNP-TCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGKSGHLR 155
            ....| .|:.|....|.|.:||... ::||::.                         ||..:.|
Mouse   154 LPPQPKKCHFCQSINHMVASCPLKA-QQGPSSQ-------------------------GKPAYFR 192

  Fly   156 RECDE 160
            .|.:|
Mouse   193 EEEEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_611739.1 PTZ00368 6..161 CDD:173561 33/135 (24%)
Lin28aNP_665832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CSP_CDS 42..111 CDD:239905 33/135 (24%)
Flexible linker 113..136 9/44 (20%)
AIR1 <120..>183 CDD:227414 21/80 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..209 7/47 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.