DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Lin28a

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_665832.1 Gene:Lin28a / 83557 MGIID:1890546 Length:209 Species:Mus musculus


Alignment Length:135 Identity:33/135 - (24%)
Similarity:47/135 - (34%) Gaps:49/135 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCT 91
            |||||     ...|..|...|..|::.|.|                 .:|||.|.|:.|.:|:|.
Mouse   111 GPGGV-----FCIGSERRPKGKNMQKRRSK-----------------GDRCYNCGGLDHHAKECK 153

  Fly    92 QADNP-TCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGKSGHLR 155
            ....| .|:.|....|.|.:||... ::||::.                         ||..:.|
Mouse   154 LPPQPKKCHFCQSINHMVASCPLKA-QQGPSSQ-------------------------GKPAYFR 192

  Fly   156 RECDE 160
            .|.:|
Mouse   193 EEEEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 33/135 (24%)
Lin28aNP_665832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CSP_CDS 42..111 CDD:239905 33/135 (24%)
Flexible linker 113..136 9/44 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..209 7/47 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.