DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT5G52380

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_200051.1 Gene:AT5G52380 / 835314 AraportID:AT5G52380 Length:268 Species:Arabidopsis thaliana


Alignment Length:138 Identity:46/138 - (33%)
Similarity:66/138 - (47%) Gaps:26/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAE-----RCYRCNGIGHISKDCTQADNPT--- 97
            ||:..:|         |:.|:...|.|:.|||::|     .|.:|...||..|:|.:.:|.:   
plant    69 GMKPGEG---------CFICHSKTHIAKLCPEKSEWERNKICLQCRRRGHSLKNCPEKNNESSEK 124

  Fly    98 --CYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCPETSK-------TCYGCGKSGH 153
              ||.|..|||.:.:||..:.:.|....||:.|...|||||||||...       .|..||...|
plant   125 KLCYNCGDTGHSLSHCPYPMEDGGTKFASCFICKGQGHISKNCPENKHGIYPMGGCCKVCGSVAH 189

  Fly   154 LRRECDEK 161
            |.::|.:|
plant   190 LVKDCPDK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 45/136 (33%)
AT5G52380NP_200051.1 PTZ00368 66..197 CDD:173561 45/136 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.