DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT5G36240

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_198473.1 Gene:AT5G36240 / 833621 AraportID:AT5G36240 Length:254 Species:Arabidopsis thaliana


Alignment Length:157 Identity:41/157 - (26%)
Similarity:55/157 - (35%) Gaps:54/157 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KCYKCNQFGHFARACPEEAE----RCYRCNGIGHISKDC----TQADNPTCYRCNKTGHWVRNC- 111
            |||.||..||.....|...:    .||||..:||....|    ..:.:|:|:.|.:.||:...| 
plant    54 KCYVCNSLGHLCCIEPGHTQSWTVSCYRCGQLGHTGLACGRHYDDSVSPSCFICGREGHFEHQCH 118

  Fly   112 -------PEAVNE---RGPTNVSCYKCNRT-----GHISKNCP---------------------- 139
                   ||..:|   :||.:.|......|     ||....||                      
plant   119 NSFSVCFPEDSSEDECQGPDSSSVRFQENTREEEEGHFEHQCPDSSSVCFQEISREEGFISLNSS 183

  Fly   140 --------ETSKTCYGCGKSGHLRREC 158
                    ||.:.||.|...||:.|:|
plant   184 SKSTSKGRETRRLCYECKGKGHIARDC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 41/157 (26%)
AT5G36240NP_198473.1 PTZ00368 27..213 CDD:173561 41/157 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.