DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT5G20220

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001330528.1 Gene:AT5G20220 / 832144 AraportID:AT5G20220 Length:409 Species:Arabidopsis thaliana


Alignment Length:139 Identity:39/139 - (28%)
Similarity:49/139 - (35%) Gaps:45/139 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRRNREKCYKCNQFGHFARACPE---EAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNC 111
            |:..:..|..|.|.||....|||   .|:|.:||.|                  |...||..|.|
plant   275 MKGTKFYCKNCGQEGHRRHYCPELGTNADRKFRCRG------------------CGGKGHNRRTC 321

  Fly   112 P--EAVNERGPTN--VSCYKCNRTGHISKNC-------PETS----------KTCYGCG---KSG 152
            |  :::..:|.:.  ..|..|...||.|:.|       |..|          |..|.||   |.|
plant   322 PKSKSIVTKGISTRYHKCGICGERGHNSRTCRKPTGVNPSCSGENSGEDGVGKITYACGFCKKMG 386

  Fly   153 HLRRECDEK 161
            |..|.|..|
plant   387 HNVRTCPSK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 38/137 (28%)
AT5G20220NP_001330528.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.