DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and CSDP1

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001320149.1 Gene:CSDP1 / 829758 AraportID:AT4G36020 Length:299 Species:Arabidopsis thaliana


Alignment Length:189 Identity:68/189 - (35%)
Similarity:90/189 - (47%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACP 71
            ||.|...||.::||         |:|||||||....||.:|         ||.|...|||||.|.
plant   102 CYNCGELGHISKDC---------GIGGGGGGGERRSRGGEG---------CYNCGDTGHFARDCT 148

  Fly    72 EEA------------ERCYRCNGIGHISKDCTQ-------------ADNPTCYRCNKTGHWVRNC 111
            ...            :.||.|..:||:::||||             ..|..||.|...||:.|:|
plant   149 SAGNGDQRGATKGGNDGCYTCGDVGHVARDCTQKSVGNGDQRGAVKGGNDGCYTCGDVGHFARDC 213

  Fly   112 PEAV---NER--GPTNVSCYKCNRTGHISKNCP---ETSKTCYGCGKSGHLRRECDEKG 162
            .:.|   |.|  |..:.:||.|...|||:::|.   :.|:.||.||.||||.|:||::|
plant   214 TQKVAAGNVRSGGGGSGTCYSCGGVGHIARDCATKRQPSRGCYQCGGSGHLARDCDQRG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 67/186 (36%)
CSDP1NP_001320149.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1903
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2412
orthoMCL 1 0.900 - - OOG6_101988
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X357
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.