DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT3G43590

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_189945.1 Gene:AT3G43590 / 823456 AraportID:AT3G43590 Length:551 Species:Arabidopsis thaliana


Alignment Length:190 Identity:53/190 - (27%)
Similarity:67/190 - (35%) Gaps:66/190 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACP 71
            ||.|.:.||.|:||       |.....|..|.                 .|.:|..|||....|.
plant   210 CYICKKTGHRAKDC-------PDKYKNGSKGA-----------------VCLRCGDFGHDMILCK 250

  Fly    72 EEAER-------CYRCNGIGHISKDCTQADNP-----TCYRCNKTGHWVRNC------------- 111
            .|..:       ||.|...||:.  |.:..|.     :||||.:.||....|             
plant   251 YEYSKEDLKDVQCYICKSFGHLC--CVEPGNSLSWAVSCYRCGQLGHSGLACGRHYEESNENDSA 313

  Fly   112 -PEAV-NERGPTNVSCYKCNRTGHISKNCP-----------ETSKTCYGCGKSGHLRREC 158
             ||.: |.|..:  .||:|...||.::.||           |:...||.|..|||..|||
plant   314 TPERLFNSREAS--ECYRCGEEGHFARECPNSSSISTSHGRESQTLCYRCNGSGHFAREC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 53/190 (28%)
AT3G43590NP_189945.1 AIR1 130..280 CDD:227414 24/95 (25%)
PTZ00368 210..374 CDD:173561 53/190 (28%)
ZnF_C2HC 327..342 CDD:197667 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.