DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and AT3G43490

DIOPT Version :10

Sequence 1:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_189935.1 Gene:AT3G43490 / 823435 AraportID:AT3G43490 Length:260 Species:Arabidopsis thaliana


Alignment Length:39 Identity:14/39 - (35%)
Similarity:21/39 - (53%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 VSCYKCNRTGHISKNCPETS---KTCYGCGKSGHLRREC 158
            |:||.|....||:.:||..:   |:|:.|....|..|:|
plant   143 VTCYSCGEKDHITVSCPTLTNCRKSCFICASLEHGARQC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_611739.1 PTZ00368 6..161 CDD:173561 14/39 (36%)
AT3G43490NP_189935.1 PTZ00368 <137..>181 CDD:173561 13/37 (35%)
AIR1 <144..226 CDD:227414 13/38 (34%)

Return to query results.
Submit another query.