DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Zcchc13

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_083434.1 Gene:Zcchc13 / 75064 MGIID:1922314 Length:170 Species:Mus musculus


Alignment Length:179 Identity:62/179 - (34%)
Similarity:86/179 - (48%) Gaps:41/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRR--------NREKCYKC 60
            |.:|:||...||:||:|.                 .||.||....|..|        ..:.||:|
Mouse     3 SKSCFKCGHSGHWARECP-----------------KGGTRGRTARGRTRGPQCSTANQSDVCYRC 50

  Fly    61 NQFGHFARACPEEAERCYRCNGIGHISKDCTQAD---NPTCYRCNKTGHWVRNCPEAVN------ 116
            .:.||:|:.|....:.||.|...|||:||||||.   ...||.|::.||..|:|.....      
Mouse    51 GETGHYAKDCDLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDCNRQEEQKCYTC 115

  Fly   117 ------ERGPTNVSCYKCNRTGHISKNCPETSK-TCYGCGKSGHLRREC 158
                  ::..|.:.||:|...||::.||.:||: :||.||:||||.|||
Mouse   116 GEFGHIQKDCTQIKCYRCGENGHMAVNCSKTSEVSCYRCGESGHLAREC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 61/177 (34%)
Zcchc13NP_083434.1 PTZ00368 46..167 CDD:173561 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4609
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53072
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 1 1.000 - - FOG0005222
OrthoInspector 1 1.000 - - otm44047
orthoMCL 1 0.900 - - OOG6_101988
Panther 1 1.100 - - O PTHR23002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.