DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Zcchc9

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_663428.2 Gene:Zcchc9 / 69085 MGIID:1916335 Length:271 Species:Mus musculus


Alignment Length:122 Identity:34/122 - (27%)
Similarity:49/122 - (40%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAV 115
            ::|...|:.|.|.||....||...|......||              ||||..|.|.:..|...|
Mouse   124 KKNAMVCFHCRQPGHGIADCPAVLESQDMGTGI--------------CYRCGSTEHEMSKCRANV 174

  Fly   116 NERGPT-----NVSCYKCNRTGHISKNCPETSK-------TCYGCGKSGHLRRECDE 160
            :   |.     ...|:.|...||:|::||:.:|       :|..||...|.:::|.|
Mouse   175 D---PALGEFPFAKCFVCGEMGHLSRSCPDNTKGVYADGGSCKLCGSVEHFKKDCRE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 34/122 (28%)
Zcchc9NP_663428.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
PTZ00368 <130..229 CDD:173561 33/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.